General Information

  • ID:  hor001847
  • Uniprot ID:  Q69GG1
  • Protein name:  Pea-FMRFa-3
  • Gene name:  NA
  • Organism:  Periplaneta americana (American cockroach) (Blatta americana)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Periplaneta (genus), Blattinae (subfamily), Blattidae (family), Blattoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GHDFDQDDVNSSGEKDESLVRI
  • Length:  22(84-105)
  • Propeptide:  MGVGIIIAMHALFFFMYHIASSDVLDGTNTIDNVAALDISEDEDDCEPESSITSLPLKRAEEQNQPPPVRRRCSNRNFVRLGRGHDFDQDDVNSSGEKDESLVRIGRGGRSNDNFIRFGRGGKNDNFIRFGRGGKQDNFIRFGRDRSDNFIRFGRGKTDNFIRFGRGRSDNFIRFGRGKSDNFIRFGRARPDNFIRFGRGKQDFIRFGRGNSNFVRFGRDDSSNVETFDTEEEATTDSTLRVGRGGKSGSNFIRF
  • Signal peptide:  MGVGIIIAMHALFFFMYHIASS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excitatory effects of antenna鈥揾eart;reduce the spike frequency of dorsal鈥恥npaired median neurons and reduce the intracellular calcium concentration
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q69GG1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001847_AF2.pdbhor001847_ESM.pdb

Physical Information

Mass: 283729 Formula: C101H156N30O42
Absent amino acids: ACMPTWY Common amino acids: D
pI: 3.91 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -121.82 Boman Index: -8195
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 61.82
Instability Index: 3415.45 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15355317
  • Title:  Unique accumulation of neuropeptides in an insect: FMRFamide-related peptides in the cockroach, Periplaneta americana